PROTEIN SEQUENCE :

VTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSD
SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKH
YKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKP

ALLOWED CHARACTERS :
ABCDEFGHIKLMNPQRSTUVWXYZ
Warning: B,U,Z are substituted in X because some softwares don't understand them.

RESIDUE CODES :

   A   alanine               B   aspartate or asparagine
   C   cystine               D   aspartate
   E   glutamate             F   phenylalanine
   G   glycine               H   histidine
   I   isoleucine            K   lysine
   L   leucine               M   methionine
   N   asparagine            P   proline
   Q   glutamine             R   arginine
   S   serine                T   threonine	
   U   selenocysteine        V   valine
   W   tryptophan            X   any
   Y   tyrosine              Z   glutamate or glutamine

SEQUENCE IDENTIFIERS :
The sequence identifiers must have at least six characters.
The allowed characters are : ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz_0123456789


User : public@54.204.172.174. Last modification time : Wed Feb 13 09:01:43 2002. Current time : Tue Feb 21 22:10:35 2017